LL-37 5MG KIT

LL-37 5MG KIT Specification

Dosage Form
Lyophilized Powder for Reconstitution

Salt Composition
LL-37 Acetate

Indication
Research Use Only (Not for Human or Veterinary Use)

Enzyme Types
Antimicrobial Peptide (AMP)

Feature
High Purity (>98%), Sterile, Endotoxin-Free

Ingredients
LL-37 Peptide, Sterile Water for Injection, Bacteriostatic Water (Optional)

Application
Peptide Research, Antimicrobial Studies, Cell Culture Applications

Ph Level
Neutral (pH 6-7 upon Reconstitution)

Temperature Needed For Fermentation
Not Applicable (Synthetic Product)

Physical Color/Texture
White to Off-White Lyophilized Powder

Fermentation Smell
Odorless

Enzymatic Activity
Non-enzymatic, Antimicrobial Mechanism

Storage Instructions
Store at 2-8C; For long-term storage, store at -20C

Shelf Life
24 Months (When Properly Stored)

Reconstitution Volume
5 mg per vial, reconstitute as per requirement

Transport Condition
Shipped with Ice Packs or Dry Ice

Appearance After Reconstitution
Clear, Colorless Solution

Intended Use
Laboratory Research, Pharmaceutical Development

Inactivation
No Enzyme Inactivation Necessary

Peptide Purity
>98% (by HPLC)

CAS Number
219685-34-2

Solubility
Soluble in Water or Acetic Acid (0.1M)

Sequence
[LL-37, 37 aa]

Quality Control
QC Certified, HPLC and MS Analyzed

Molecular Weight
4493.28 Da

Packaging Type
Vial (5 mg per kit) with Optional Sterile Water Ampoule

About LL-37 5MG KIT

Discover the rare LL-37 5MG KIT, a laureate in antimicrobial peptide research now available at an affordable price for a limited time only. Renowned for its uncommon purity (>98%, HPLC), this famed lyophilized peptide is QC certified and MS analyzed, ensuring optimal consistency for laboratory research and pharmaceutical advancement. Easily reconstituted in water or acetic acid, it appears as a clear, colorless solution. Each kit arrives in a secure 5 mg vial with optional sterile water ampoule, preserved under cold-chain standards for unwavering quality and longevity. Intended for research applications only.

Versatile Uses and Superior Features of the LL-37 5MG KIT

The LL-37 5MG KIT is primarily used for peptide research, antimicrobial studies, and various cell culture applications. Application is straightforward: reconstitute the lyophilized, high-purity powder in water or acetic acid to achieve a neutral pH. The kit boasts exceptional features such as being sterile, endotoxin-free, and non-enzymatic. Its acclaimed quality makes it suitable for advanced laboratory and pharmaceutical investigations, where outstanding purity and reliability are paramount for scientific progress.

Efficient Delivery, Certified Assurance, and Export Options

Experience quick dispatch with the LL-37 5MG KIT, ensuring fast international delivery through reliable FOB ports. Customers receive an estimated delivery timeline upon order, underscoring our commitment to timeliness. Each kit is QC certified, HPLC and MS analyzed, guaranteeing research-grade authenticity. We offer comprehensive export solutions to meet global demand, maintaining uncompromised quality throughout the supply chain, and delivering a premium product that adheres to strict international standards for your peace of mind.

FAQ's of LL-37 5MG KIT:

Q: How should LL-37 5MG KIT be stored for maximum shelf life?

A: To maintain its 24-month shelf life, keep the LL-37 5MG KIT stored at 2-8C for short-term use or at -20C for long-term preservation. Ensure vials remain tightly sealed and protected from excessive moisture or direct sunlight.

Q: What are the recommended reconstitution and application methods for the LL-37 kit?

A: Reconstitute each vial with sterile water or 0.1M acetic acid, based on your laboratory's specific needs. The solution should appear clear and colorless; always use aseptic techniques when preparing and handling the peptide.

Q: Where can I use the LL-37 5MG KIT in research?

A: The LL-37 5MG KIT is ideal for laboratory research, peptide studies, antimicrobial assays, and cell culture applications, specifically designed for investigative use in pharmaceutical development and not for human or veterinary use.

Q: When will I receive my order of the LL-37 5MG KIT?

A: Quick dispatch is prioritized for every order, with delivery times estimated upon your purchase confirmation. Shipping is handled via FOB ports, and products are securely transported with ice packs or dry ice to ensure quality on arrival.

Q: What certifications and quality controls are associated with the LL-37 5MG KIT?

A: Each kit is quality control certified, analyzed by HPLC and MS, and verified to be sterile and endotoxin-free, ensuring the product meets stringent international research standards.

Tell us about your requirement